McDonnell Genome Institute

Washington University

CircRNA

chr4|75804133|75812375|+|USO1|ENST00000264904.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.923

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

DLGHPDLQLEELR

Amino Acids from 5' Exons

DLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQL,ISNLRNGSRFLHNVKMNSSRRQSHSKYHRSSSTKTSIIFLKYS,SPTGIKAAGFYIKMSKTAPDGSHTASITDPAAQRPVSSNTA

Amino Acids from 3' Exons

NEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHP,MKLKLCLRKELPLKSSWIHLIVPLPFYKLRKTNSWKLQILKKNKMISWCSWPIKIRKYCHRINSRILVI,NSSVGKNCHRAAGFIYHCHFTNERQTRVGNYRFKRTRSLGALGRSRSENTVIEETQGSWSS