McDonnell Genome Institute

Washington University

CircRNA

chr4|75657556|75662049|-|G3BP2|ENST00000357854.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.935

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

7

Peptide

FMQTFVLAPEHLTLCSK

Amino Acids from 5' Exons

DIHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPE,IYTTKYYLTSVNVILKFVMWMLMQPVMELSRSWVCCLTVDNQKESLCKPLFWLL,YTPQSIISELQMSYNSSCGCSCNLEWSSCPGHGFAVQWTTRKKVYANLCSGS

Amino Acids from 3' Exons

HLTLCSKEMVMEKPSPLLVGREFVRQYYTLLNKAPEYLH,IHCAAKKWLWRSPVRCLGGSLGNIILCIKLRNIYT,FDIVQQRNGYGEAQSAACRAGVCEAILYFAESSGIFTQ