McDonnell Genome Institute

Washington University

CircRNA

chr4|75647028|75662049|-|G3BP2|ENST00000357854.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

39

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

27

7

Peptide

YPDSHQLFVGNLPHDIDENELKEFFMTFDIVQQR

Amino Acids from 5' Exons

AEEIWNRMTLTTVEFAIQIVINFLLVTCHMILMKMSRNSS,QRRYGTELQPNNSLSRSSTFCWLATYKAKGILH,RGDMEQNDSDNRRIIRYPDSHQLFVGNLPHDIDENELKEFFM

Amino Acids from 3' Exons

HLTLCSKEMVMEKPSPLLVGREFVRQYYTLLNKAPEYLH,IHCAAKKWLWRSPVRCLGGSLGNIILCIKLRNIYT,FDIVQQRNGYGEAQSAACRAGVCEAILYFAESSGIFTQ