McDonnell Genome Institute

Washington University

CircRNA

chr4|73413419|73417669|+|ALB|ENST00000295897.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

60

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

7

Peptide

MPCAEDYADLAKYICENQDSISSKLK

Amino Acids from 5' Exons

ADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLG,RTLPSISVKIKIRSPVNRNAVKNLCWKNPTALPKWKMMRCLLTCLHLLILLKVRMFAKTMLRQRMSSWA,GPCQVYLKSRFDLQTEGMLKTSVGKIPLHCRSGKDACLAFISCFCKGCLQKLCGKGCLPGH

Amino Acids from 3' Exons

AISSLHQESTPSVNSNSCRGLKKPRKSGQQMLTSSKKNALCRRL,LLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDY,YFVTPRKYPKCQLQLLRSQETEKWAANVVNILKQKECPVQKT