McDonnell Genome Institute

Washington University

CircRNA

chr4|73411995|73413634|+|ALB|ENST00000295897.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

11

Peptide

NYAEAKDVFLGMAVAR

Amino Acids from 5' Exons

GSSSPEPEISQSVCRSFQVSDRSYQSPHGMLPWRSAMCQ,AVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDR,QLAARDFPKLSLQKFPSQILPKSTRNAAMEICLNVLMT

Amino Acids from 3' Exons

ADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLG,RTLPSISVKIKIRSPVNRNAVKNLCWKNPTALPKWKMMRCLLTCLHLLILLKVRMFAKTMLRQRMSSWA,GPCQVYLKSRFDLQTEGMLKTSVGKIPLHCRSGKDACLAFISCFCKGCLQKLCGKGCLPGH