McDonnell Genome Institute

Washington University

CircRNA

chr4|71349911|71357187|+|SLC4A4|ENST00000264485.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9406

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

7

Peptide

MFTNPDNGGSSLK

Amino Acids from 5' Exons

VDQVRKSGTGWGKMEQAPCGHIVPSFIAEDMYGERIHHASGGFFSPTVG,WIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLV,GSSLKKKWNRVGKDGASPMWPHCPFIVYLSGHVWRKDPSCLIGRLLLSHSWW

Amino Acids from 3' Exons

RLLTIRLRQAYNLNLRIRPILCSGSTGIKPRNPTFGPWLTLGRQSPVQVGCLPTLIM,DDCPSDDRPIETTGGDLYFAPEAPASNQEIQPSVPGHWEDSLQCKDVYQP,MIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDN