McDonnell Genome Institute

Washington University

CircRNA

chr4|6923372|6999202|+|TBC1D14|ENST00000409757.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.912

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

LETLCSPGIMR

Amino Acids from 5' Exons

FLLGPRLMENSPPLQMAPSWVFWMVDQETPFRTCNTSISRRPDSSPRLSTGPSNSGLKTGTASSPWTRGFLPWRSGTRSLYPAARSTGGSSPTPTSSPSGPSRAPARCHPVRHQLLAAPSGNRACANPPRFPGQAMTRSSIARPPKPPAAMMSPSAACPVLGQSCPPRCPSAMRTSWTLWSRAAPVPLPWRMTMTHSLPTSPALSRKPVAYTSRTVFMKLRRGVNKYWGHLVTSLQ,FSLDQDDWKTLHLYKWRSLHGYSGWSTRKPPSEPATRQSQGAPTPLRAVRAQAETQGFRRPAQPPVRGLGDSYPGDREPGACTLQRGPREEEAVRLRPHPRAGLPERLRAAILCATSSQHRAGTERAQILHVSQDRLLGKALPDLQSPDPQRCLRLQRVQSWDRAVHHAVRQQGHLGPCGHEQLQCHCDPGERPTVYQRHLELYQGNPWLTPAGLCSSGGEIENIGAILLCK,SPWTKMTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKLKLRALEDRHSLQSVDSGIPTLEIGNPEPVPCSAVHVRRKQSDSDLIPERAFQSACALPSCAPPAPSSTEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDPQFTNVTLSSIKETRGLHQQDCVHEAEEGSKLKILGPFSNFFA

Amino Acids from 3' Exons

SKKPSEGRSSWKKDAESRKALETLCSPGIMRSYLTGKQ,AERSPAKEEAAGRKMQSRGKHWKRCAHLEDLTLGNN,LKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWET