McDonnell Genome Institute

Washington University

CircRNA

chr4|6923372|6967424|+|TBC1D14|ENST00000409757.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9807

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

EVIWESATPR

Amino Acids from 5' Exons

FLLGPRLMENSPPLQMAPSWVFWMVDQETPFRTCNTSISRRPDSSPRLSTGPSNSGLKTGTASSPWTRGFLPWRSGTRSLYPAARSTGGSSPTPTSSPSGPSRAPARCHPVRHQLLAAPSGNRACANPPRFPGQAMTRSSIARPPKPPAAMMSPSAACPVLGQSCPPRCPSAMRTSWTLWSRAAPVPLPWRMTMTHSLPTSPALSRKPVAYTSRTVFMKLRRGVNKYWGHLVTSLQ,FSLDQDDWKTLHLYKWRSLHGYSGWSTRKPPSEPATRQSQGAPTPLRAVRAQAETQGFRRPAQPPVRGLGDSYPGDREPGACTLQRGPREEEAVRLRPHPRAGLPERLRAAILCATSSQHRAGTERAQILHVSQDRLLGKALPDLQSPDPQRCLRLQRVQSWDRAVHHAVRQQGHLGPCGHEQLQCHCDPGERPTVYQRHLELYQGNPWLTPAGLCSSGGEIENIGAILLCK,SPWTKMTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKLKLRALEDRHSLQSVDSGIPTLEIGNPEPVPCSAVHVRRKQSDSDLIPERAFQSACALPSCAPPAPSSTEREQSVRKSSTFPRTGYDSVKLYSPTSKALTRSDDVSVCSVSSLGTELSTTLSVSNEDILDLVVTSSSSAIVTLENDDDPQFTNVTLSSIKETRGLHQQDCVHEAEEGSKLKILGPFSNFFA

Amino Acids from 3' Exons

ELACKTKCKAQTQLGMEVIWESATPRECPEGFKENTE,NLLARKQSARLDKHNDLGWKLFGKAPLRENAQKDSKRIQK,TCLLENKVQGLTNTMTWDGSYLGKRHSERMPRRIQREYR