McDonnell Genome Institute

Washington University

CircRNA

chr4|6842066|6864183|+|KIAA0232|ENST00000307659.5

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

TNLVMAQLK

Amino Acids from 5' Exons

ENDIFLGWEKGAYKKWGKSKKKCSDLTLEEMKKQAAVQCLRSASDE,RMTSSWAGKKELIRNGERVRKNVQILKKKNRLLSSVFDLLLM,EHLPGLGKRSLEMGKEEKMFRSNSRRNEKTGCCPVSSICF

Amino Acids from 3' Exons

VLSISTTFETSLPARNHDCVEQVSLFLLLFFIIHSPTSHRYFLSGLQQKSHQGKKQSTHHCAENPEQKQKREGKQIWHNRKACFVQKANPTTRKDSPSLVVFWLQSRLKFQWESGRIKSIHEVCSKTQGTRDSKQKRAEWAKQAFFEARKGKEHSYWKQQQWFCQTAVQAGETFKRNREKRSWEHRKRPVHGEKGHRVRGALVVHRANCIFCSSEQKKTRDHIPKQTGYKSDIRGSGRIVISAWSLYQQQSSNIPRSRYFHWSFCRNACSYKGYPHWDLIMFSTRGQIPGYSSIRINALLSGYSIHVGSWCLRNNARRKSDFEYDSTEKQREHRFGRMLHSVRWYGVARGTCNMDRFYQLRRCGLIPAGPWQSGSVLGVLFIQLRCWGEFWRRLSSTLSHLRQHSAQFTPACWQSRALFRYRIWYKLLFFSVSAMQFCFTIFFNTQLGKKYRFCYAWENTVIANMDQKCLRKTLFSFNKNLSMVPFRRNTFRQNIKYSVRIHTVCRRYLCSSSLVKLCRRTSRFFARNLPAKQNFRDSYISFQKNITRIRLWYSARTKNRKQKFNYTSMKSTWRWLQLRGYRHLDKDGRHKFCGYSRNRKNCVVFGRCKLLLLSRCSTGDPSGAGCAEVRVPSVGGTEREPGEKSICFAIKRGWWLYNTLTLGCSPRRKHIHSWRSLWRTQNLQWGVGSRTTSHKRKSVTVCSFCCDDSWYRCLYDPRKQFCSWAQAVMETLRVITESAEEWGKWVKGIFFYLPRLTRSLWQLSSRRSWTILIFFLLKQSIFTSSSCRMLITRDCIFQPQFTEINPLFFRQSVSPQDMWCQNTIQGYSDLSSDSLSPNFCIRTVPRRRKRVRIIERSKYSHSFSSYIRSAGRSQTFGRRCRERRPLLWKIRAVWKIPSQVKKIWDGKECSDITGFPGGINWDSFSRKAKSVFGMHEIPGNRFRKLRSKLNNGTMRGRNFLWLQSRLSVSCLRSSFFGTAGR,YYEAFPPLSEKPVCLQEIMTVWNKSKVCSYSSSSSSSTAPPASTDTSSPKDCNSESEVTKERSSEVPTTVHEKTQSKSKNEKENKFSNGTIEEKPALYKKQIRHKPEGKIRPRSWSSGSSEAGSSSSGNQGELKASMKYVKVRHKAREIRNKKGRNGQSRLSLKHGEKAERNIHTGSSSSSSSGSVKQLCKRGKRPLKEIGRKDPGSTEGKDLYMENRKDTEYKEEPLWYTEPIAEYFVPLSRKSKLETTYRNRQDTSDLTSEAVEELSESVHGLCISNNNLHKTYLAAGTFIDGHFVEMPAVINEDIDLTGTSLCSLPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMIRQKSKENTDFEAECCIVLDGMELQGERAIWTDSTSSVGAEGLFLQDLGNLAQFWECCSSSSGDADGESFGGDSPVRLSPILDSTVLNSHLLAGNQELFSDINEGSGINSCFSVFEVQCSNSVLPFSFETLNLGNENTDSSANMLGKTQSRLLIWTKNSAFEENEHCSNLSTRTCSPWSHSEETRSDNETLNIQFEESTQFNAEDINYVVPRVSSNYVDEELLDFLQDETCQQNSRTLGEIPTLVFKKTSKLESVCGIQLEQKTENKNFETTQVCNESPHGDGYSSGVIKDIWTKMADTNSVATVEIERTDAELFSADVNNYCCCLDAEAELETLQEPDKAVRRSEYHLWEGQKESLEKRAFASSELSNVDGGDYTTPSKPWDVAQDKENTFILGGVYGELKTFNSDGEWAVVPPSHTKGSLLQCAASDVVTIAGTDVFMTPGNSFAPGHRQLWKPFVSFEQNDQPKSGENGLNKGFSFIFHEDLLGACGNFQVEDPGLEYSFSSFDLSNPFSQVLHVECSFEPEGIASFSPSFKPKSILCSDSDSEVFHPRICGVDRTQYRAIRISPRTHFRPISASELSPGGGSESEFESEKDEANIPIPSQVDIFEDPQADLKPLEEDAEKEGHYYGKSELESGKFLPRLKKSGMEKSAQTSLDSQEESTGILSVGKQNQCLECSMNESLEIDLESSEANCKIMAQCEEEINNFCGCKAGCQFPAYEDNPVSSGQLEE,TMKHFHHFLRNQFACKKSLCGTSLKSVLTLALLHHPQPHQLAQILPLLRTATVKVKSPRKEAVKYPPLCMRKPRAKAKTRRKTNLVMAQLKKSLLCTKSKSDINLKERFALARGLLAPVKQAQVPVGIRENKHPSMLKDTRHERFETKKGGMGKAGFLSTVKRLKGTFILEVVAVAAVVLSNSCASGVRDLKKGEKILGALKEKTCTWRIERTQSIKRSPCGTPSQLLNILFLAEKVNRPHTETDRIQVIHQRQWKNCLNQCMVFVSATIIFIKHTSQQVLSLMVILKCLQLMRILTSLGPHYVLYQRTINTWMIFIYQNRTSMKWILINPCWILVPQKQCKEKVGFIFDRKAKRTQILRQNVACMVWSCKGNVQYGQILPAPVLRAYSCRTLAIWLSFGSAVHPAPVMLMGRVLEETLQLDSLPSTAQCSIHTCLLAIKSSFQILMKDLVTLVFQCLKCNAVILFYHFLLKHSTWEMKIQILVLICLGKHSLDCYGPKIVPLKKMNTVLIFQQELVVHGPIQKKHVQTMKHIFSLKNPHSLMPKILIMFLESRQIMMKNFIFCKMKLASKTVELVRFLHFSKKHLNNPSVVFSNKKQKTKILKLHKYVMKVHMEMATAQGLLKTFGQRWQTQILWLQKKELMLSCFRQMITTAAVMLKLNWRPFRSLIRLCGGQSTICGRDRKRAWRKEHLLLVSYQTWMVVIIQHPLNPGMPKIKKTHSFLEEFMENSKPSIVMGSGQSYHLVTQKEVCYSVQLLMLRLVQMSLPQETVLLLGTGSYGNPSCHLNRMISRRVGKMGIRDFLLSSMKTYELVATFKSKILDLNTHFLPLTAIHFHKFFMNAHLNLKGLHLSAPVLNRNQSSVLIQTVKCFTPGYVVLTEHNTGLFGSLLGLTFAQFLHPNCPQEEEASQNLNLRKMKQIFPFLLKLIYLKIRRQISNLWKKMQRKKAITMENQSLSLENSFPGKNLGWKRVLRHHWIPRRNQLGFFQESKISVWNVAMNPWKIKAQKQIVKWHNARKKLIIFVVAKQVVSFLLMKIIQFLRDSWK