McDonnell Genome Institute

Washington University

CircRNA

chr4|56011411|56011985|+|CEP135|ENST00000257287.4

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9511

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

4

Peptide

EIQEEISLELEAAVQEK

Amino Acids from 5' Exons

EISLELEAAVQEKEEMKSRVHKYITEVSRWESLMAAK,KSHWNWKQQCKKKKKRAEFINTQRCHDGRAWLP,NLIGIGSSSARKRRNEEQSSIHNRGVTMGELNGCQ

Amino Acids from 3' Exons

EKENQDLLDRFQMLHNRAEDWEVKAHQAEGESSSVRLELLSIDTERRHLRERVELLEKEIQE,KKKIKICIDFRCFITVLKTGRSKPIKLREKAAQFDWNFFLLTLRGDIFEKEWSYKKKFK,KRKSRFVRISDASPCRLGGQSPSSGRKQLSSTGTSFYHEETSSRKSGAIRKRNSR