McDonnell Genome Institute

Washington University

CircRNA

chr4|55965643|55985358|+|CEP135|ENST00000257287.4

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9414

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

LTCVNHQVDFLQQANK

Amino Acids from 5' Exons

VDFLQQANKDLEKRIRELMETKETVTSEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAK,LTFFSKLIKTWRSVYESLWKPRKQHLKSLIVTKMKNSAKNLKISHSSWKDIKKKCLRLLIKSLGKQ,LSSASRPGEAYTRAYGNQGNSDISRFKQKKTLPRINNRSVSTAVGKTRRSADCRAWGSK

Amino Acids from 3' Exons

HIEEVSLFGKSELEKTIEHLTCVNHQ,ILKKVFLENQNRKLLNIHVLII,YRSESFWKIRIRENYTFDMCSS