McDonnell Genome Institute

Washington University

CircRNA

chr4|55957222|55971408|+|CEP135|ENST00000257287.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9451

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

11

Peptide

LSKKVESFAVTGGK

Amino Acids from 5' Exons

VARKEVLLSGASVCKLMNRFLPLKSVHIQFLNQMTLTLQTSFKWLIT,WQEKKYCFQAPAYANTGSSLSQFISSSSTRPLHCRPPSSGQ,GKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADN

Amino Acids from 3' Exons

ELNLCQKEKERLSDELLVKSDLETVVHQLEQEKQRLSKKVESFAVT,NTYARKKRRDVMNSLNQTKLLFISLNKKSKDLAKKLKVLQLQ,IELMPERKGETETPCKIRPRNCCSSATRKAKTQKSKFCSY