McDonnell Genome Institute

Washington University

CircRNA

chr4|55893551|55902538|+|EXOC1|ENST00000346134.11

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9507

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

LINIYVK

Amino Acids from 5' Exons

ERYDPPNDDNISLHARAEQPNCIRRQNLLSLYVSQNESSCVDCTKCGPCFFPKYYIGKCFGDCQKELQMH,KDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCI,KISAKLKYFAALSQSTTLHETKLIALTLFICSKVIMCGLHKMWTLLLSVLHWEMFWLSKGTLTNA

Amino Acids from 3' Exons

HFFEGVEARVAQGIREEEVSYQLAFNKQELRKVIKEYPGKEVKKGLDNLYKKVDKHLCEEENLLQ,ISLKVLKLAWHRAGRRKVTNLHLTNKNFVKSLRSTLERKKKVITSTRKLINIYVKKRTYF,FLRCSSRGTGHKGGGSKLPTCIQTRTSSHGVPWKGSKKRSRPLQESTFMRRELTS