McDonnell Genome Institute

Washington University

CircRNA

chr4|55893551|55893780|+|EXOC1|ENST00000346134.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9221

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

GTLTNALK

Amino Acids from 5' Exons

ERYDPPNDDNISLHARAEQPNCIRRQNLLSLYVSQNESSCVDCTKCGPCFFPKYYIGKCFGDCQKELQMH,KDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCI,KISAKLKYFAALSQSTTLHETKLIALTLFICSKVIMCGLHKMWTLLLSVLHWEMFWLSKGTLTNA

Amino Acids from 3' Exons

ERYDPPNDDNISLHARAEQPNCIRRQNLLSLYVSQNESSCVDCTKCGPCFFPKYYIGKCFGDCQKELQMH,KDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTAQNVDPASFLSTTLGNVLVTVKRNFDKCI,KISAKLKYFAALSQSTTLHETKLIALTLFICSKVIMCGLHKMWTLLLSVLHWEMFWLSKGTLTNA