McDonnell Genome Institute

Washington University

CircRNA

chr4|55890222|55896900|+|EXOC1|ENST00000346134.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9641

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

GVFVNGLHGSSGK

Amino Acids from 5' Exons

VFMEVRGNLDLLLVISSVFRVQGIADLSHLPCWIWETCLPLISMLLTGPNLI,SSWKFGEINWIYFSKAQCSEFRESQISVIFPVGYGKHVCLSRCCQDQI,LHGSSGKLTGSTSSLNKLSVQSSGNRRSQSSSLLDMGNMSASDLDVADRTKFDK

Amino Acids from 3' Exons

SNQIRQMEEVKISKKSKVGILPFVAEFEEFAGLAESIFKNAERRGDLDKAYTKLIRGVFVN,VTKGKWKKRSQKRVKLEFFHLLLNLKNLLDLQNQSSKMLSVVETWIKHTPNLSEEYLLM,PNKANGRSKDLKKESWNSSICCIRICWTCRINLQKCASWRPGSIHQTYQRSIC