McDonnell Genome Institute

Washington University

CircRNA

chr4|515972|527230|+|PIGG|ENST00000310340.9

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9858

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

TFPSDIR

Amino Acids from 5' Exons

VISDIQSTSNRRMWLRHWRHLAYRFQKTVGASYSQLWKEDQESSDFYIIQCSLVNCCKRMCRHMKK,YPTSKARPTDGCGCDTGDSTWLTDSKRQCREPPIPSCGRKTNERAVEIFTFEYSAATVARECAVIK,DIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVEGRPMREQLRFLHLNTVQLSKLLQENVPSYEK

Amino Acids from 3' Exons

LPQSRALCPGCPLPPRSFCAGAEGVLPCVQGCPGAGAAGRLLLPGGHRECPVPVAAGQQGHFQ,SDHKAELSVLAALSLLVVFVLVQRGCSPVSKAALALGLLGVYCYRAAIGSVRFPWRPDSKDIS,LTTKPSSLSWLPSPSSFLCWCRGGAPLCPRLPWRWGCWASTATGRPSGVSGSRGGRTARTFP