McDonnell Genome Institute

Washington University

CircRNA

chr4|505717|508970|+|PIGG|ENST00000310340.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9132

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

3

Peptide

GNPALMTGSLPGFVDVIR

Amino Acids from 5' Exons

ALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGKRIVFYGDETWVKLFPKHFVEYDGTTSFFVSDYTE,HRGAFLALSTSSGTSILLHCWKTVDKQKQLEKESFMEMKPGLNYSQSILWNMMEQPHFSCQITQ,IDDGEPSWLCRRHQEPQFSCTAGRQCDKTSKSSWKKNSLLWRNLGIIPKAFCGIWNNLIFRVRLHR

Amino Acids from 3' Exons

ERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKP,RERRLYPICWFFVVTMACLKQEVTGPPPPRRIHLFSVLRLKGNP,ERDAFTQFAGSLWPWHVNRKSRGLLHRGGEYTSDFNQFCVKET