McDonnell Genome Institute

Washington University

CircRNA

chr4|48998459|49038180|+|CWH43|ENST00000226432.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9876

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

RCSTAVLGK

Amino Acids from 5' Exons

RCSTAVLGKWIDASILFVVSWYWFDLVGY,GAVLLCLASGLMLPSCLWFRGTGLIWWVT,VQYCCAWQVDCFHLVCGFVVLVSGGLQ

Amino Acids from 3' Exons

RPRQETAGYCCFKTTEKLSSDISGIYHFSTWLQRLSTAHTWQCE,DDLDRKLQAIAVSKLLKSSSNQVIFLGYITSAPGSRDYLQLTEHGNVK,MTSTGNCRLLLFQNYKVALIKYFWDISLQHLAPEIIYSSLNMAM