McDonnell Genome Institute

Washington University

CircRNA

chr4|48156679|48228659|-|TEC|ENST00000381501.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9884

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

SENTGIFSGR

Amino Acids from 5' Exons

MVLQKYEKQGRATPPQ,WYCRNMNRSKAEQLLRSE,GIAEIIEARQSNSSAV

Amino Acids from 3' Exons

NTGIFSGRRSNQKTEMNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAE,ILGSSVAGGVIRRRRILTLFWRRFLLKGHSRKRRHRPTTKRDFLYLQSPCPTMRVEQ,YWDLQWQEESEDGDEFHYFGGDSYKVTAEKEDIALKLQRETFCTYKVHANLLGSSR