McDonnell Genome Institute

Washington University

CircRNA

chr4|47903192|47914205|-|NFXL1|ENST00000329043.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9645

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LSLALGWK

Amino Acids from 5' Exons

VWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWP,FGAVRDVSVYFTCPVSRSGLKTASFLYLLLMMILERKIVPGL,LELFGMFLYISHALYPEVGRQPVSCIFCDFWKERLSLAL

Amino Acids from 3' Exons

GWKLPGARWPVAEADPGDGPLPPPQEMESISAAPEEGERRGRWAQFLLAPVPEESRPRRLQGAGTAPQDPKPCRLPQPA,DGSFLAPGGRWPRPIPGTGHCRPLRKWSPSPRRRRRAREGVGGRSSFWHQSRRSRDHGGCREQAQPRRIPSPADYRSQ,MEASWRQVAGGRGRSRGRATAAPSGNGVHLRGAGGGREKGSVGAVPSGTSPGGVATTAAAGSRHSPAGSQALQTTAAS