McDonnell Genome Institute

Washington University

CircRNA

chr4|47903192|47910994|-|NFXL1|ENST00000329043.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9759

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

IVPGLELMSQK

Amino Acids from 5' Exons

VWSCSGCFCIFHMPCIQKWAKDSQFLVSSVTDDDFGKKDCPWP,FGAVRDVSVYFTCPVSRSGLKTASFLYLLLMMILERKIVPGL,LELFGMFLYISHALYPEVGRQPVSCIFCDFWKERLSLAL

Amino Acids from 3' Exons

SCLRKNLKKSRKLTKLQPENLLKNSLALHLKKEMKILKENREKYLQIRLHTLLRQ,ANVSEKIRNQESPSCSQKTCRTVLFIRRRRFRKTGKNTCKYVYNIHYSD,LMSQKKFEEIKKANQAAARKLVEEQFSSSSEEGDEDFEGKQGKILANTFITYTTQT