McDonnell Genome Institute

Washington University

CircRNA

chr4|44689842|44695734|+|GUF1|ENST00000281543.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9522

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

3

Peptide

ETLGFLGLLHMEVFNQR

Amino Acids from 5' Exons

ARISWTFAHGSFQPATGARICFCYFNNPYCSISCTVIIKIDK,LGFLGLLHMEVFNQRLEQEYNASVILTTPTVPYKAVLSSSKLIK,DFLDFCTWKFSTSDWSKNIMLLLFQPLLFHIKLYCHHQN

Amino Acids from 3' Exons

RQSSFNWQSHMTAEGFSSATVDSNSSCYWKNHCKRN,DKAHSIGKAICERLKDSLPRQLFEIAIQAAIGSKIIARE,TKLIQLAKPYVNGRILFLGNCLRQFKLLLEVKSLQEK