McDonnell Genome Institute

Washington University

CircRNA

chr4|4274366|4274769|-|LYAR|ENST00000343470.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

KDSASEEEAR

Amino Acids from 5' Exons

EPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEARVGAGKRKRRHSE,NQSIRNRINGHSTQWQIHMQKSPPRFQPPKKTPWNSKGRRRIKEKERKNGRRKGKEKRKNSKTTRKTQGIRSLRSAKRDRRLTLRLVGRKSLRPMALQGRGARRRSSARTAPVRKRHAWAQGRGSGGTRK,TSQGTGSTATPPSGKSTCRNLHQGSSLQSERRRGTARGGEEEKRKKGRTAEEKEKRKERTKVRKPPGKLKESEAEAQKGTGGPGWWGGSPGQWLCREEEQEEEAAQGQRQGRGTRGRREEEAEALG

Amino Acids from 3' Exons

EPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQRKDSASEEEARVGAGKRKRRHSE,NQSIRNRINGHSTQWQIHMQKSPPRFQPPKKTPWNSKGRRRIKEKERKNGRRKGKEKRKNSKTTRKTQGIRSLRSAKRDRRLTLRLVGRKSLRPMALQGRGARRRSSARTAPVRKRHAWAQGRGSGGTRK,TSQGTGSTATPPSGKSTCRNLHQGSSLQSERRRGTARGGEEEKRKKGRTAEEKEKRKERTKVRKPPGKLKESEAEAQKGTGGPGWWGGSPGQWLCREEEQEEEAAQGQRQGRGTRGRREEEAEALG