McDonnell Genome Institute

Washington University

CircRNA

chr4|41631147|41671594|+|LIMCH1|ENST00000503057.5

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

FVHFGPVTELDQQK

Amino Acids from 5' Exons

GWRCSAHLCFAFPRNSRNCHSLCQPQSKGLESFQPQAKVCALWASDGARSAEMEAAHWQGWARGRRSHLSWQQDSNGLCVSCLSGHFQLKGPPNISTKLQ,DGDVQHICASEPSPEIKAETAIRDDFANRKARASKKASSPRQKFVHFGPVTELDQQKWKRLSIGKAGPREDEEEVICHGSKIQMDSVSPVSAATSSLKGHQIFNRQNDC,MEMFSTSVLLSLPQKLKQKLPFVMTLPTAKQGPLRKLPAPGKSLCTLGQRSISRNGSGLALARLGLERMKKKSSVMAARFKWTLCLLSQRPLPARATKYLIDKMTA

Amino Acids from 3' Exons

WILQAVRSHLLH,GFSKQEVTCYDT,DSPSSEKSPVMTP