McDonnell Genome Institute

Washington University

CircRNA

chr4|40893264|40945073|-|APBB2|ENST00000508593.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9943

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

10

Peptide

DTVGIWGEQIYGVITHFR

Amino Acids from 5' Exons

CFAVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGE,VLLCVLWDGRWQKRTSPPVKVVLRSTTASGNFPTAKMTSETQSGFGE,FCCAFSGMGRDGRRGPRPRKCCGQQLHQATFLLQKHPRHSRDLGR

Amino Acids from 3' Exons

QIYGVITHFRLIQICRLAGKESVTLPGPIIGTSQQERLSGNGPSPSQQISRVLGKGHLVLRHLPPQRT,RYMESLISDSRFAAWLEKSQHCRDLLLAHPNRNDSVGTARLHPSRSPGFERVTFCNAISHPRER,DIWSDHSFQTDPDLPPGWKRVSDIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENE