McDonnell Genome Institute

Washington University

CircRNA

chr4|40893264|40945070|-|APBB2|ENST00000295974.12

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9081

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

LSGNGPSPSQQISR

Amino Acids from 5' Exons

CFAVRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGE,VLLCVLWDGRWQKRTSPPVKVVLRSTTASGNFPTAKMTSETQSGFGE,FCCAFSGMGRDGRRGPRPRKCCGQQLHQATFLLQKHPRHSRDLGR

Amino Acids from 3' Exons

IYGVITHFRLIQICRLAGKESVTLPGPIIGTSQQERLSGNGPSPSQQISRVLGKGHLVLRHLPPQRT,YMESLISDSRFAAWLEKSQHCRDLLLAHPNRNDSVGTARLHPSRSPGFERVTFCNAISHPRER,IWSDHSFQTDPDLPPGWKRVSDIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENE