McDonnell Genome Institute

Washington University

CircRNA

chr4|40432650|40436885|-|RBM47|ENST00000510871.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9988

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LLLQAGSIR

Amino Acids from 5' Exons

PSLPLGLSIPCFQQLQPLKLKMAKSTQWSTSAPLLCSQTQPVLLPPQPRPQPPQPLSFPLCRRHHLS,SHPCHWGSVFHVSSSSSPNDRWQNPHSGAHDQPHCCAARPSQCCCRRSRGRSRRSRCHSHCVDATTFP,AIPAIGAQYSMFPAAPAPKMIEDGKIHTVEHMISPIAVQPDPASAAAAAAAAAAAAAAVIPTVSTPPPFQ

Amino Acids from 3' Exons

IQSKLTLQVCLLYEDMLRMQIAEIECWKHLYQPIKEQRCSHLQLRLGQLNAENRGLRSASSTVTVGCSSFVLLLQAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVNPVAIKPGT,YNPRNSPCKFASCTKKTCLGCKSRLKNVGSIFTSLLKSKGVATCNDWGSMPRTEGGLPPAPSLLVADHLLCCYYKQAAEAEGEVQLATEPQGLGVPTSGDILLVVVYIADIMKGKESSKKKDMNWCRIWKSLPSTQLPLNLVQ,TILETHPASLPLVLRRHADANLGNRMLEASLPAYRAKVPPAIKTGAVKCREPRAEVCLQHRHCWLLIIFCVVITSRQHKRPRARCSWQQSPRAGFLPRGIFCWSWYIPISRERKAARKRITGAEFGNPYRQPSCHTWY