McDonnell Genome Institute

Washington University

CircRNA

chr4|39904039|39922748|-|PDS5A|ENST00000303538.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9397

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

5

Peptide

LLHIYYQNSIDDNNSHNK

Amino Acids from 5' Exons

WRVRKEAMMGLAQLYKKYCLHGEAGKEAAEKVSWIKDKLLHIYYQNSIDD,GEEKKLWVWLSFIRNTVFMVKQERKLQRKSAGRTNFCIFIIRTALTT,ASKKRSYDGSGSALEILSSWSRKGSCRESQLDKGQTSAYLLSEQHRQ

Amino Acids from 3' Exons

QPQEGTNAHARFDEFYHHGRWSYSRIIGLHSYPHSCT,NSHNKKVQMHMLDLMSSIIMEGDGVTQELLDSILINLIPAHK,IATIRRYKCTCIVLSSWKVMELLKNYWTPFLLTSFLHI