McDonnell Genome Institute

Washington University

CircRNA

chr4|39510660|39514184|-|UGDH|ENST00000316423.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.967

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

13

Peptide

IFDANTKPNLNLQPGLKEVVESCRGK

Amino Acids from 5' Exons

VNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQ,ILQQKPMEWGKAGQQISILKLVLDALCKTQMGTKLLRKAQFQCGQQKVSVAYLMQTQNPTIY,EYSNKNLWNGERPGSRSEVYSLCTHCAKLKWVQNCDEKHSSSAGSRKYPSHICKHKTQLEFT

Amino Acids from 3' Exons

PGLKEVVESCRGKNLFFSTNIDDAIKEADLVFIS,QDKKWNPVEEKIFFFLPILMMPSKKLILYLF,RTKRSGRILSRKKSFFFYQYCHQRSSCIYF