McDonnell Genome Institute

Washington University

CircRNA

chr4|39504416|39510550|-|UGDH|ENST00000316423.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9825

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

15

Peptide

MFKVLSNPEFLAEGTAIK

Amino Acids from 5' Exons

CPGSPFPRIHMKHVMVPMLLLFALSGTCL,VPARDHFQGSISMWCPCCCYLHVGHV,SRLVTISKDPYEACDGAHAVVICTEWDMFK

Amino Acids from 3' Exons

VLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKL,CCPTLSFWQREQPSRTRTQTEYLEGMKLQRARELCRPCVLYMSTGFPEKRSSPLILGLQSFPN,AVQPVSGRGNSHQGPKEPRQSTDWRGNSRGPESCAGPVCCIALGSQRKDPHHYLVFRAFQT