McDonnell Genome Institute

Washington University

CircRNA

chr4|39185725|39194659|+|WDR19|ENST00000399820.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9993

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

DLAWRTNTVCLAK

Amino Acids from 5' Exons

RIFSLLEKTWLGAPIQFAWQKTSGNYLAVT,VFSHCKRLGLAHQYSLPGKKHQETTLQQ,YFLTARKDLAWRTNTVCLAKNIRKLPCSNR

Amino Acids from 3' Exons

GSNVFPSLVKSWKFPGCWNCRKFAYLSSDISKDSCP,DQMSFLLWSKVGSFLAVGTVKGNLLIYNHQTSRKIPVL,IKCLSFFGQKLEVSWLLELLKEICLFIIIRHLERFLSL