McDonnell Genome Institute

Washington University

CircRNA

chr4|38931450|38935790|+|FAM114A1|ENST00000358869.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

KFTNSLTTVGAMK

Amino Acids from 5' Exons

AMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIE,PRGLMTGWKRIKPWCQMWQKCPKKKQRRKKRKRNLKTLKKTKRRKRKLRP,HEEGSLGGRGSNRGVSRCGKSVRRRNKEGRKGREISRPSRRQKGGKENDHR

Amino Acids from 3' Exons

INYCNVQSGLFIKEVYEFFNHCW,LTTAMCNEVASLSKKFTNSLTTVG,LLQCAMKWPLYQRSLRILPLL