McDonnell Genome Institute

Washington University

CircRNA

chr4|38914920|38935790|+|FAM114A1|ENST00000358869.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.927

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

FTNSLTTVGMLR

Amino Acids from 5' Exons

MLREAKEKEKQRLAQQLTMERTAHYGMLFDEYQGLSHLEALEILSNESESK,CGKLRRRRSRDWHSSSRWREPRTTGCCLMNIKACHTWKPWKFCPMKAKA,VKGSGEGEAETGTAAHDGENRALRDAVISRLVTPGSPGNSVQKRKQ

Amino Acids from 3' Exons

INYCNVQSGLFIKEVYEFFNHCW,LTTAMCNEVASLSKKFTNSLTTVG,LLQCAMKWPLYQRSLRILPLL