McDonnell Genome Institute

Washington University

CircRNA

chr4|38089931|38118192|+|TBC1D1|ENST00000261439.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9241

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

VFDYSELGELPPR

Amino Acids from 5' Exons

IIQSWESFPHDLLNQFVKMGPLAPHQRKRKGHLVSSESCGKRLFFNRYCCLEWRRKIRSSK,LFRAGRASPTISFRTSLRWALWPPTRGKEKDISAPRAVAKGYSSTDTAANGEGKSEAP,YSELGELPPRSPLEPVCEDGPFGPPPEEKKRTSRELRELWQKAILQQILLLRMEKENQKLQ

Amino Acids from 3' Exons

IQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTMFASQFPLGFVARVF,SRCTSSRGCFMITTETSTITWRSTRSAPASTLPPGSSPCLPHSSRWDSPESL,PDVPALEVASLPQRPLQSPGGARDRPQPLRCPLVPHHVCLTVPAGIRSQSL