McDonnell Genome Institute

Washington University

CircRNA

chr4|36114169|36128745|-|ARAP2|ENST00000303965.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9027

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

4

Peptide

GDIWATFEVIENEELGLGCK

Amino Acids from 5' Exons

ISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIENEEL,YLLWKQKNLMIYRKILFLQKVIFGPHLKSLKMKS,ISCDGSRRINYISDKKYYSYKRYLGHISHKRA

Amino Acids from 3' Exons

VDANISIKRMVILCIVNSWRVSKRMQEALNGLENISLKMRLCKVFSLTLMMHCLLRSSTHIGSLL,FRMQIYLSKEWSFAYKTPGEFQKGCKKLIEGWKTSARCDGCVEKFSLHCTAYGALPILDLCF,LGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDALLTKELYPYWISAL