McDonnell Genome Institute

Washington University

CircRNA

chr4|3342936|3343053|+|RGS12|ENST00000336727.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9281

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

LGGELDSLSLLNAR

Amino Acids from 5' Exons

GSKFGRGTGLTQPSQRTSARRSFGRSKRFSITRSLDDLE,AQNLGGELDSLSLLNARLLGDHLGDPRDSVSLAPLMIL,LKIWAGNWTHSAFSTHVCSEIIWEIQEIQYHSLPS

Amino Acids from 3' Exons

GSKFGRGTGLTQPSQRTSARRSFGRSKRFSITRSLDDLE,AQNLGGELDSLSLLNARLLGDHLGDPRDSVSLAPLMIL,LKIWAGNWTHSAFSTHVCSEIIWEIQEIQYHSLPS