McDonnell Genome Institute

Washington University

CircRNA

chr4|3211928|3217952|+|HTT|ENST00000355072.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9174

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

4

Peptide

VPPLEFNLSLLAPCLSLGMSEISGGQK

Amino Acids from 5' Exons

EFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLF,SSTACLHAAGVKFLVARRVPFLKQPVRLWPVAAPCSSSLLSIMSSSPSCLQSRRPTGASMICL,VQPKPASSMLKPRDENFWWPEECPFSSPGDSGPCERHRAAAPCCPSCLPARAACRAGGLLEQVESV

Amino Acids from 3' Exons

ILSISLQPVRWWQKWWSLCSRCWPWVIKGIAACRRFSRHCGTSSSAWPACPLSTATHVCPH,SVYHCSLDGGRNGGVSAVGVGLGSKERRAGVSHAIAKEHHHQPGPPAPCQQLHTCAPT,PKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPL