McDonnell Genome Institute

Washington University

CircRNA

chr4|3154292|3157199|+|HTT|ENST00000355072.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

13

Peptide

LHDVLKATHANYKAALPSLTNPPSLSPIR

Amino Acids from 5' Exons

AALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASA,QPCLLQTPLLVPSDERGRRKNQENKHLYRVPRKAVRPVQ,SLAFSNKPPFSKSHPTKGEGERTRRTSICTVESQERQGQC

Amino Acids from 3' Exons

LLDNLIPQVLLQQVNPHHWGVSIIFLHTSNCMMSKLHTLTT,FTIYLRSCYNKILITGEFLSSSFIPQTACPESYTRLQ,SRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYK