McDonnell Genome Institute

Washington University

CircRNA

chr4|3127263|3131775|+|HTT|ENST00000355072.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.967

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

VPLDTTEYPASVK

Amino Acids from 5' Exons

PQRMRSVESWLLLQGFPLQGQQVMTSSQNSHGHSTHCRRTQWIWPAVTQALPLMGMRRISATAPARSAPSHLTLPWTMMGPRPRRPSATAPRPPPKGLIQLLPLQTVLK,LSEGDQWRAGCFFRGFHSRVSRSHHHRTATVTAHTAGGLSGSGQLLDKLCHWGGGYLEPQLQPGQRRPIPCHGPEWDPGLVAHQRQLPDHHRRAFSCYPFRQFN,SVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVDLASCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDSAVTPSDSSEI

Amino Acids from 3' Exons

CWFRTGMGSARPWPSAVWEQLWPSTRNLSSANSIKFLLTPRNTL,AGSGQGCEGQREGPGPQLCGSSCGPPPGIFLQQTLSSSHHGIP,LVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYP