McDonnell Genome Institute

Washington University

CircRNA

chr4|30920152|30920369|+|PCDH7|ENST00000509759.2

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

LGALPLPEDNYER

Amino Acids from 5' Exons

PFRRVTFSVVSQPQDPHQGSLQSCYDSGLEESETPSSKSSSGPRLGALPLPEDNYERTTPDGSVGEAEHMEN,HFVERFLLVSLRTHIRGHCRVAMTAGWRSQKHQAVRVHQGQDWVRFHSQRTTMKGPRRMAVLVRQSIWKM,ISSDVFCCESASGPTSGVTAELLQRAGGVRNTKQEFIRAKTGCASTPRGQLKDHAGWQCWGRAYGK

Amino Acids from 3' Exons

PFRRVTFSVVSQPQDPHQGSLQSCYDSGLEESETPSSKSSSGPRLGALPLPEDNYERTTPDGSVGEAEHMEN,HFVERFLLVSLRTHIRGHCRVAMTAGWRSQKHQAVRVHQGQDWVRFHSQRTTMKGPRRMAVLVRQSIWKM,ISSDVFCCESASGPTSGVTAELLQRAGGVRNTKQEFIRAKTGCASTPRGQLKDHAGWQCWGRAYGK