McDonnell Genome Institute

Washington University

CircRNA

chr4|2949933|2950213|-|NOP14|ENST00000314262.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

41

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

8

Peptide

DELPYTFAGWKDECR

Amino Acids from 5' Exons

DGKMNVEEDVQEEQSKEASDPESNEEEGDSSGGEDTEESDSPDSHLDLESNVESEEENEKPAKEQRQTPGKGLISGKERAGKATRDELPYTFA,MERMSRKMSRKSKARKPVTLRATRKKVTVQAGRTQRRATAQIATWTWNPTWRVRKKTRSQQKSRGRLLGKGAARKELEKLPETSCPTRSQ,WKDECRGRCPGRAKQGSQPEQRGRRQFRRGGHRGERQPRPLGPGIQRGEGRKREASKRAEADSWERVDKRQGKSWKSYQRRAALHVR

Amino Acids from 3' Exons

DGKMNVEEDVQEEQSKEASDPESNEEEGDSSGGEDTEESDSPDSHLDLESNVESEEENEKPAKEQRQTPGKGLISGKERAGKATRDELPYTFA,MERMSRKMSRKSKARKPVTLRATRKKVTVQAGRTQRRATAQIATWTWNPTWRVRKKTRSQQKSRGRLLGKGAARKELEKLPETSCPTRSQ,WKDECRGRCPGRAKQGSQPEQRGRRQFRRGGHRGERQPRPLGPGIQRGEGRKREASKRAEADSWERVDKRQGKSWKSYQRRAALHVR