McDonnell Genome Institute

Washington University

CircRNA

chr4|2914883|2926112|+|ADD1|ENST00000264758.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9929

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

KGELVTASK

Amino Acids from 5' Exons

GELVTASKAIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSE,ESWRPPRPSLKRSTSPTSLAPRAPTPSPHSQTVSWRSTAGRWRGSRRALK,RAGDGLQGHHKGVPAPRHCEHHGPQPLHHTHRPAGGVPQGGGEEAEGL

Amino Acids from 3' Exons

RIWTRLENRKKRVLQTSLRSPTRLPALPSSWRK,ESGRGRTERKESSRPACGPPPASQHSHQAGG,NLDEAREQKEKSPPDQPAVPHPPPSTPIKLEE