McDonnell Genome Institute

Washington University

CircRNA

chr4|2820613|2825196|+|SH3BP2|ENST00000511185.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

VQGDWGCGPAGTR

Amino Acids from 5' Exons

LHGGRDALACPYEGHWCPEPANHAWGRGQGWLPAQEGRYPAAAAE,FMAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLK,SWRLKRCIGLSLRPLVPRTCPCLGAWPRLATCTRRAVPSCSCN

Amino Acids from 3' Exons

GDAGGGDHVQQRFPLQDHPYQQEAPHVVLLGLLRGGAQGDWGSEDECKVTGGVGLQAPGWTCLGGSLVLGRWPLSPGQREGVAGTQAAGWVLPQLHPHAQSLVPAPTQGTCCPGRCPCGLRGATQPCCIQPGRLLPWESQQSRQGSEGGGVRWGPPWWHRAHHSPADLQSWMALLRREIGHFHEKKDLPLDT,VMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKVTGGPRTSARLGVWACRHQAGPALGARWSWGAGLSAPGKEKVWLGHRQLGGCCPSSIPMPRAWCQRPHKEHAVLGGAPVGGEPHSHVVSSRVASSDLGSHSRAGRAVKVEGCGGAHPGGTVPTTAPLTCRAGWPCCAGRLATSTKRKTCPWTP,CGRLRRPRPTTFSPSRSSISARSTARGSSRPPPRRSARLGVRGRVQGDWGCGPAGTRLDLPWGLAGPGALASQPRAKRRCGWDTGSWVGAAPAPSPCPEPGASAHTRNMLSWEVPLWAEGSHTAMLYPAGSPPLTLGVTAEQAGQRWRGAVGPTLVAPCPPQPRPAELDGLAAQGDWPLPRKERPALGHQ