McDonnell Genome Institute

Washington University

CircRNA

chr4|2696362|2700544|+|FAM193A|ENST00000324666.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9493

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

LPPAAPTSR

Amino Acids from 5' Exons

PPAAPTSRNYAEMREKLRLRLTKRKEEQPKKMDQISERESVVDHRRVEDLLQFINSSETKPVSSTRAAKRARHKQRK,LQLHQQVEIMQKGKSFAYGPRGKRSNLKKWTRSQKGKASLTIGGWRICCSLIAPKPNQAARVQRSEQGISKG,SSCTNKKLCRNEGKASLTADQEERGATKNGPDLRKGKRRPSEGGGFVAVYKLRNQTSEQHACSEASKAAKE

Amino Acids from 3' Exons

LEEKARLEAEARAREHLHLQEEQRRREEEEDEEEEEDRFKEEFQRLQELQKLRAVKKKKKERPSKDCPKLDMLTRNFQAATESVPNSGNIHNGSLEQTEEPETSSHSPSRHMNHSEPRPGLGADGDAADPVDTRDSKFLLPKEVNGKQHEPLSFFFDIMQHHKEGNGKQKLRQTSKASSEPARRPTEPPKATEGQSKPRAQTESKAKVVDLMSITEQKREERKVNSNNNNKKQLNHIKDEKSNPTPMEPTSPGEHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSI,WRRKLAKQRPGPGSTCTSRRSRGGGRRRRMRKKRRIVSRRNFSGFRSFRSELKRRRRRGQVKTAPSWTCSLEISRQQQSLFLTLETSTMAHSKLKNQKPLLTPHPGITTQSPGQGGLMGMLQTPSTPETPNFSSPRRMGSSMSHSLFSSTSCSTIKKEMASRSGRPARPAASQRGGPQSPPRPQRGSPSPGPRLSQRLRWSTSCPSQSRKERREKSTVITITKSSTTSRTKSQTQPLWSPPLPVSISRTASWCWQSPLSQRARTRKIRRRKETESTIQL,GGESSPRSRGQGPGAPAPPGGAEAAGGGGGGRRGGSFQGGISAASGASEAKSCKKEEEGEAKRLPQVGHAHKFPGSNRVCSLWKHPQWLTRANRTRNLFSLPIQAYEPLRAQARARGWGCCRPRRHQRLQISPPQGGEWEAAATLFFLRHHAAPRRKWQAEAEADQQGQQRASEEAHRAPQGHRGAVQAPGPDVKGGGRPHVHHRAEKRGEKSQQQQKAAEPHQGRKVKPNPYGAHLSRASAEQQAGAGRVPSAKGQEQEKEEERRQSQQFN