McDonnell Genome Institute

Washington University

CircRNA

chr4|2630934|2631169|+|FAM193A|ENST00000324666.9

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

DPYQLYQR

Amino Acids from 5' Exons

ALREGPLPAVPASGTASSRVCAGDEGPPAPAAVGCGQGEGTIWPAGPAASAPVHLPPAGVRRPLPGRTLHQHLPWHS,LCERDPYQLYQRLEQQAREYVLEMKVRLLRQLSAAAKVKAPSGLQGPPQAHQFISLLLEEYGALCQAARSISTFLGTL,SARGTPTSCTSVWNSKLESMCWRRSACSGSCRLRPRRHHLACRARRKRTSSSPSCLRSTAPSARPHAPSAPSLAL

Amino Acids from 3' Exons

ALREGPLPAVPASGTASSRVCAGDEGPPAPAAVGCGQGEGTIWPAGPAASAPVHLPPAGVRRPLPGRTLHQHLPWHS,LCERDPYQLYQRLEQQAREYVLEMKVRLLRQLSAAAKVKAPSGLQGPPQAHQFISLLLEEYGALCQAARSISTFLGTL,SARGTPTSCTSVWNSKLESMCWRRSACSGSCRLRPRRHHLACRARRKRTSSSPSCLRSTAPSARPHAPSAPSLAL