McDonnell Genome Institute

Washington University

CircRNA

chr4|2596083|2596329|+|RNF4|ENST00000508235.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9259

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

KDSSFLESGIK

Amino Acids from 5' Exons

TPFSFGMNHRTPPYPAGDYCLLCRSERKDSSFLESGIKTASKLALSMAPKGNSVLHLPLWVCPDCRRTVEKEERHGGLDQPV,LLLVLAIIGHHPTLLGIIVFCAEVNGKTHHSRVELRLRANWPFPWLPRATACCTCHCGCARTAAGPWRRRRGMAALTSQ,SFFWHESDTTLPCWGLLSSVQKTERLIILREWNDCEQIGPFHGSQGQQRAAPATVGVPGLPQDRGEGGEAWRPPAS

Amino Acids from 3' Exons

TPFSFGMNHRTPPYPAGDYCLLCRSERKDSSFLESGIKTASKLALSMAPKGNSVLHLPLWVCPDCRRTVEKEERHGGLDQPV,LLLVLAIIGHHPTLLGIIVFCAEVNGKTHHSRVELRLRANWPFPWLPRATACCTCHCGCARTAAGPWRRRRGMAALTSQ,SFFWHESDTTLPCWGLLSSVQKTERLIILREWNDCEQIGPFHGSQGQQRAAPATVGVPGLPQDRGEGGEAWRPPAS