McDonnell Genome Institute

Washington University

CircRNA

chr4|25779075|25822128|-|SEL1L3|ENST00000264868.9

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

40

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

HSLEILR

Amino Acids from 5' Exons

TLAGEYFHKAAQGGHMEGTLWCSLYYITGNLETFPRDPEKAV,LLVNISIRLRKVDTWKGPCGVLSTISQATWRHSLEILRKLL,FSWIFPGCARWTHGRDLVVFSLLYHRQPGDIPRSESCC

Amino Acids from 3' Exons

LPGGFPLHSWVLHYWREQVCGWHRVFWTPEVLSPSQSAPRP,FREDFHYNDTAGYFIIGGSRYVAGIEGFFGPLKYYRLRSLHPAQ,SGRISIIMTQLGTSLLEGAGMWLALKGFLDPSTIAFAVCTPP