McDonnell Genome Institute

Washington University

CircRNA

chr4|24819858|24876697|-|CCDC149|ENST00000389609.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

ELDTCQQER

Amino Acids from 5' Exons

GARTPYCSATPLFLVDRGRDPHCSLSSSPLRTKQIPRM,GQGHHTVQRPHSSWTEVEIPTAEVCRAAHEQSRSQG,GKDTILFSDPTLPSGQRSRSPLLKFVEQPTENKADPKD

Amino Acids from 3' Exons

YLVCKRKLESKKEALLILSKELDTCQQERDQYKLMANQLRERHQSLKKKYRELI,TWCVRGSWRVRRKPCSSPRSWTPVNRKGTSTNSWPISSGSATSHRRSTES,PGVEEAGEEGSPADPLQGAGHLSTGKGPVQTHGQSAPGAPPVTEEEVPRAD