McDonnell Genome Institute

Washington University

CircRNA

chr4|24540107|24542022|-|DHX15|ENST00000336812.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9333

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

5

Peptide

SYLLLLCCQVYNPR

Amino Acids from 5' Exons

LLKLEPWNFITWLLMMMEILNWDPWQSFLIHSSQKWLLQVVTTTVLMRSYLLLLCCQ,SNSDESPGTFELPGCFKWRSDIGIHDGRVSSRSTARKNGYCKLLQLFGPIYYCYVV,PETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLS

Amino Acids from 3' Exons

VYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQ,STILESELSPFWQLLVKLQLSKGLVELDVPDLENASDFTQRKLIKQKC,LQSSNQSVPFGDSYSFSSAKGWSSWTYQTWKMLQTLHRESLNRNA