McDonnell Genome Institute

Washington University

CircRNA

chr4|24532863|24537173|-|DHX15|ENST00000336812.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9012

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

9

Peptide

ALVTGYFMQSHSVLFAPR

Amino Acids from 5' Exons

IMNRFSGVMTTSLTTGPCPQTMYASSYLELWTDLICLVEVLTLQAGTIILIEKLWLLGILC,SIGSVVLQLHLQVPDVRRQCTPAAISNYGQIFASSKYLYKQGLLYYKKSFGYWVFYA,HESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQ

Amino Acids from 3' Exons

SHSVLFAPRRPRKPQMRPRDLPTMEIIHCTSTMLLNK,PTVFCSPHGGQESRRGQDEICPHRWRSSDTAERLPCFT,PQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQ